Versions Compared

Key

  • This line was added.
  • This line was removed.
  • Formatting was changed.

The make fragments API generates rosetta fragments Rosetta fragment libraries based on an input sequence. API jobs are submitted like this:

Table of Contents

Quickstart

Code Block
cyrus engine submit make-fragments --sequence SECVENGGFCPDPEKMGDWCCGRCIRNECRNG

The job returns the following outputs

...

Inputs

  • --sequence (str)

    • Input sequence to generate fragment libraries for

Outputs

  • 3mers.tgz

    • library of 3mer fragments

  • 9mers.tgzA

    • library of 9mer fragments

  • pssm.tgzThe

    • PSSM produced during fragment generation

  • sequence-profile.tgzthe

    • BLAST .chk checkpoint file produced during fragment generation